SCOPe 2.08: Domain d1aoca_: 1aoc A:

Lineage for d1aoca_ (1aoc A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.5: Coagulogen [57531] (1 protein)
   automatically mapped to Pfam PF02035

6. Protein Coagulogen [57532] (1 species)

7. Species Japanese horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [57533] (1 PDB entry)

8. Domain d1aoca_: 1aoc A: [44817]
   complexed with so4

Details for d1aoca_

PDB Entry: 1aoc, 2 Å

PDB Description: japanese horseshoe crab coagulogen

PDB Compounds: (A:) coagulogen

SCOPe Domain Sequences for d1aoca_:

Sequence; same for both SEQRES and ATOM records:

>d1aoca_ g.17.1.5 (A:) Coagulogen {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}
adtnapiclcdepgvlgrtqivtteikdkiekaveavaqesgvsgrgfsifshhpvfrec
gkyecrtvrpehsrcynfppfthfksecpvstrdcepvfgytvagefrvivqapragfrq
cvwqhkcrfgsnscgyngrctqqrsvvrlvtynlekdgflcesfrtccgcpcrsf

Timeline for d1aoca_:

• d1aoca_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoca_ appears in SCOPe 2.07