Lineage for d1qfwb_ (1qfw B:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703620Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 1703645Protein Gonadotropin B chain [63396] (1 species)
  7. 1703646Species Human (Homo sapiens) [TaxId:9606] [63398] (3 PDB entries)
  8. 1703649Domain d1qfwb_: 1qfw B: [44814]
    Other proteins in same PDB: d1qfwa_, d1qfwh_, d1qfwi_, d1qfwl_, d1qfwm_
    complexed with nag

Details for d1qfwb_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
PDB Compounds: (B:) gonadotrophin beta subunit

SCOPe Domain Sequences for d1qfwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwb_ g.17.1.4 (B:) Gonadotropin B chain {Human (Homo sapiens) [TaxId: 9606]}
keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcdd

SCOPe Domain Coordinates for d1qfwb_:

Click to download the PDB-style file with coordinates for d1qfwb_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwb_: