Class g: Small proteins [56992] (66 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulphide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) |
Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins) |
Protein Gonadotropin B chain [63396] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63398] (3 PDB entries) |
Domain d1qfwb_: 1qfw B: [44814] Other proteins in same PDB: d1qfwa_, d1qfwh_, d1qfwi_, d1qfwl_, d1qfwm_ complexed with nag |
PDB Entry: 1qfw (more details), 3.5 Å
SCOP Domain Sequences for d1qfwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfwb_ g.17.1.4 (B:) Gonadotropin B chain {Human (Homo sapiens)} keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcdd
Timeline for d1qfwb_: