Lineage for d1btgc_ (1btg C:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40812Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 40813Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 40877Family g.17.1.3: Neurotrophin [57520] (3 proteins)
  6. 40878Protein beta-Nerve growth factor [57525] (2 species)
  7. 40882Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries)
  8. 40886Domain d1btgc_: 1btg C: [44804]

Details for d1btgc_

PDB Entry: 1btg (more details), 2.5 Å

PDB Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound

SCOP Domain Sequences for d1btgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btgc_ g.17.1.3 (C:) beta-Nerve growth factor {Mouse (Mus musculus)}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

SCOP Domain Coordinates for d1btgc_:

Click to download the PDB-style file with coordinates for d1btgc_.
(The format of our PDB-style files is described here.)

Timeline for d1btgc_: