SCOPe 2.01: Domain d1btga_: 1btg A:

Lineage for d1btga_ (1btg A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries)

8. Domain d1btga_: 1btg A: [44802]
   complexed with zn

Details for d1btga_

PDB Entry: 1btg, 2.5 Å

PDB Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound

PDB Compounds: (A:) beta nerve growth factor

SCOPe Domain Sequences for d1btga_:

Sequence; same for both SEQRES and ATOM records:

>d1btga_ g.17.1.3 (A:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkat

Timeline for d1btga_:

• d1btga_ first appeared (with stable ids) in SCOP 1.55
  
• d1btga_ appears in SCOP 1.75
  
• d1btga_ appears in SCOPe 2.02
  
• d1btga_ appears in the current release, SCOPe 2.08