Lineage for d1btga_ (1btg A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204064Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 204065Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 204134Family g.17.1.3: Neurotrophin [57520] (3 proteins)
  6. 204135Protein beta-Nerve growth factor [57525] (2 species)
  7. 204139Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries)
  8. 204141Domain d1btga_: 1btg A: [44802]

Details for d1btga_

PDB Entry: 1btg (more details), 2.5 Å

PDB Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound

SCOP Domain Sequences for d1btga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btga_ g.17.1.3 (A:) beta-Nerve growth factor {Mouse (Mus musculus)}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkat

SCOP Domain Coordinates for d1btga_:

Click to download the PDB-style file with coordinates for d1btga_.
(The format of our PDB-style files is described here.)

Timeline for d1btga_: