SCOPe 2.07: Domain d1beta_: 1bet A:

Lineage for d1beta_ (1bet A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57526] (4 PDB entries)

8. Domain d1beta_: 1bet A: [44801]

Details for d1beta_

PDB Entry: 1bet, 2.3 Å

PDB Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor

PDB Compounds: (A:) Beta-nerve growth factor

SCOPe Domain Sequences for d1beta_:

Sequence; same for both SEQRES and ATOM records:

>d1beta_ g.17.1.3 (A:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka

Timeline for d1beta_:

• d1beta_ first appeared (with stable ids) in SCOP 1.55, called d1bet__
  
• d1beta_ appears in SCOPe 2.06
  
• d1beta_ appears in the current release, SCOPe 2.08