Lineage for d1bet__ (1bet -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144107Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 144108Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 144177Family g.17.1.3: Neurotrophin [57520] (3 proteins)
  6. 144178Protein beta-Nerve growth factor [57525] (2 species)
  7. 144182Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries)
  8. 144183Domain d1bet__: 1bet - [44801]

Details for d1bet__

PDB Entry: 1bet (more details), 2.3 Å

PDB Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor

SCOP Domain Sequences for d1bet__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bet__ g.17.1.3 (-) beta-Nerve growth factor {Mouse (Mus musculus)}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka

SCOP Domain Coordinates for d1bet__:

Click to download the PDB-style file with coordinates for d1bet__.
(The format of our PDB-style files is described here.)

Timeline for d1bet__: