Lineage for d1b98a_ (1b98 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2585103Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2585133Protein Neurotrophin 4, NT4 [57523] (1 species)
  7. 2585134Species Human (Homo sapiens) [TaxId:9606] [57524] (3 PDB entries)
  8. 2585138Domain d1b98a_: 1b98 A: [44799]
    homodimer
    complexed with cl

Details for d1b98a_

PDB Entry: 1b98 (more details), 2.75 Å

PDB Description: neurotrophin 4 (homodimer)
PDB Compounds: (A:) protein (neurotrophin-4)

SCOPe Domain Sequences for d1b98a_:

Sequence, based on SEQRES records: (download)

>d1b98a_ g.17.1.3 (A:) Neurotrophin 4, NT4 {Human (Homo sapiens) [TaxId: 9606]}
elavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadnaeeggpg
aggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrt

Sequence, based on observed residues (ATOM records): (download)

>d1b98a_ g.17.1.3 (A:) Neurotrophin 4, NT4 {Human (Homo sapiens) [TaxId: 9606]}
elavcdavsgwvtdrrtavdlrgrevevlgevlrqyffetrckadnaeeggpgaggggcr
gvdrrhwvseckakqsyvraltavgwrwiridtacvctllsrt

SCOPe Domain Coordinates for d1b98a_:

Click to download the PDB-style file with coordinates for d1b98a_.
(The format of our PDB-style files is described here.)

Timeline for d1b98a_: