Lineage for d1b8mb_ (1b8m B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063985Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1063986Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1064134Family g.17.1.3: Neurotrophin [57520] (5 proteins)
  6. 1064159Protein Neurotrophin 4, NT4 [57523] (1 species)
  7. 1064160Species Human (Homo sapiens) [TaxId:9606] [57524] (3 PDB entries)
  8. 1064161Domain d1b8mb_: 1b8m B: [44798]
    Other proteins in same PDB: d1b8ma_
    heterodimer with BDNF

Details for d1b8mb_

PDB Entry: 1b8m (more details), 2.75 Å

PDB Description: brain derived neurotrophic factor, neurotrophin-4
PDB Compounds: (B:) protein (neurotrophin-4)

SCOPe Domain Sequences for d1b8mb_:

Sequence, based on SEQRES records: (download)

>d1b8mb_ g.17.1.3 (B:) Neurotrophin 4, NT4 {Human (Homo sapiens) [TaxId: 9606]}
gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadnaeeggp
gaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra

Sequence, based on observed residues (ATOM records): (download)

>d1b8mb_ g.17.1.3 (B:) Neurotrophin 4, NT4 {Human (Homo sapiens) [TaxId: 9606]}
gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckaaggpgagg
ggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra

SCOPe Domain Coordinates for d1b8mb_:

Click to download the PDB-style file with coordinates for d1b8mb_.
(The format of our PDB-style files is described here.)

Timeline for d1b8mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b8ma_