Lineage for d1b8mb_ (1b8m B:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40812Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 40813Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 40877Family g.17.1.3: Neurotrophin [57520] (3 proteins)
  6. 40895Protein Neurotrophin 4 heterodimer [57523] (1 species)
  7. 40896Species Human (Homo sapiens) [TaxId:9606] [57524] (2 PDB entries)
  8. 40898Domain d1b8mb_: 1b8m B: [44798]

Details for d1b8mb_

PDB Entry: 1b8m (more details), 2.75 Å

PDB Description: brain derived neurotrophic factor, neurotrophin-4

SCOP Domain Sequences for d1b8mb_:

Sequence, based on SEQRES records: (download)

>d1b8mb_ g.17.1.3 (B:) Neurotrophin 4 heterodimer {Human (Homo sapiens)}
gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadnaeeggp
gaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra

Sequence, based on observed residues (ATOM records): (download)

>d1b8mb_ g.17.1.3 (B:) Neurotrophin 4 heterodimer {Human (Homo sapiens)}
gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckaaggpgagg
ggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra

SCOP Domain Coordinates for d1b8mb_:

Click to download the PDB-style file with coordinates for d1b8mb_.
(The format of our PDB-style files is described here.)

Timeline for d1b8mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b8ma_