Lineage for d1b8ma_ (1b8m A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638544Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2638567Protein Brain-derived neurotrophic factor, BDNF [88882] (1 species)
  7. 2638568Species Human (Homo sapiens) [TaxId:9606] [88883] (2 PDB entries)
  8. 2638570Domain d1b8ma_: 1b8m A: [44797]
    Other proteins in same PDB: d1b8mb_
    heterodimer with NT4

Details for d1b8ma_

PDB Entry: 1b8m (more details), 2.75 Å

PDB Description: brain derived neurotrophic factor, neurotrophin-4
PDB Compounds: (A:) protein (brain derived neurotrophic factor)

SCOPe Domain Sequences for d1b8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ma_ g.17.1.3 (A:) Brain-derived neurotrophic factor, BDNF {Human (Homo sapiens) [TaxId: 9606]}
gelsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik

SCOPe Domain Coordinates for d1b8ma_:

Click to download the PDB-style file with coordinates for d1b8ma_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b8mb_