Lineage for d1b8ma_ (1b8m A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.3: Neurotrophin [57520] (3 proteins) 
Protein Neurotrophin 4 heterodimer [57523] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57524] (2 PDB entries) 
Domain d1b8ma_: 1b8m A: [44797]
Details for d1b8ma_
PDB Entry: 1b8m (more details), 2.75 Å
PDB Description: brain derived neurotrophic factor, neurotrophin-4
SCOP Domain Sequences for d1b8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8ma_ g.17.1.3 (A:) Neurotrophin 4 heterodimer {Human (Homo sapiens)}
gelsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik
SCOP Domain Coordinates for d1b8ma_:
Click to download the PDB-style file with coordinates for d1b8ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8ma_:
- d1b8ma_ appears in SCOP 1.57
- d1b8ma_ appears in the current release, SCOPe 2.08
View in 3D
