Lineage for d1b8ka_ (1b8k A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1242698Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1242699Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1242852Family g.17.1.3: Neurotrophin [57520] (5 proteins)
  6. 1242872Protein Neurotrophin 3, NT3 [88884] (1 species)
  7. 1242873Species Human (Homo sapiens) [TaxId:9606] [88885] (3 PDB entries)
  8. 1242875Domain d1b8ka_: 1b8k A: [44795]

Details for d1b8ka_

PDB Entry: 1b8k (more details), 2.15 Å

PDB Description: Neurotrophin-3 from Human
PDB Compounds: (A:) protein (neurotrophin-3)

SCOPe Domain Sequences for d1b8ka_:

Sequence, based on SEQRES records: (download)

>d1b8ka_ g.17.1.3 (A:) Neurotrophin 3, NT3 {Human (Homo sapiens) [TaxId: 9606]}
ysvcdseslwvtdkssaidirghqvtvlgeiktgnspvkqyfyetrckearpvkngcrgi
ddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcal

Sequence, based on observed residues (ATOM records): (download)

>d1b8ka_ g.17.1.3 (A:) Neurotrophin 3, NT3 {Human (Homo sapiens) [TaxId: 9606]}
ysvcdseslwvtdkssaidirghqvtvlgeivkqyfyetrckegcrgiddkhwnsqckts
qtyvraltsennklvgwrwiridtscvcal

SCOPe Domain Coordinates for d1b8ka_:

Click to download the PDB-style file with coordinates for d1b8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ka_: