Lineage for d1b8ka_ (1b8k A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033808Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 3033835Protein Neurotrophin 3, NT3 [88884] (1 species)
  7. 3033836Species Human (Homo sapiens) [TaxId:9606] [88885] (3 PDB entries)
  8. 3033838Domain d1b8ka_: 1b8k A: [44795]

Details for d1b8ka_

PDB Entry: 1b8k (more details), 2.15 Å

PDB Description: Neurotrophin-3 from Human
PDB Compounds: (A:) protein (neurotrophin-3)

SCOPe Domain Sequences for d1b8ka_:

Sequence, based on SEQRES records: (download)

>d1b8ka_ g.17.1.3 (A:) Neurotrophin 3, NT3 {Human (Homo sapiens) [TaxId: 9606]}
ysvcdseslwvtdkssaidirghqvtvlgeiktgnspvkqyfyetrckearpvkngcrgi
ddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcal

Sequence, based on observed residues (ATOM records): (download)

>d1b8ka_ g.17.1.3 (A:) Neurotrophin 3, NT3 {Human (Homo sapiens) [TaxId: 9606]}
ysvcdseslwvtdkssaidirghqvtvlgeivkqyfyetrckegcrgiddkhwnsqckts
qtyvraltsennklvgwrwiridtscvcal

SCOPe Domain Coordinates for d1b8ka_:

Click to download the PDB-style file with coordinates for d1b8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ka_: