Lineage for d1bndb_ (1bnd B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638544Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2638571Protein Neurotrophin 3, NT3 [88884] (1 species)
  7. 2638572Species Human (Homo sapiens) [TaxId:9606] [88885] (3 PDB entries)
  8. 2638573Domain d1bndb_: 1bnd B: [44794]
    Other proteins in same PDB: d1bnda_
    heterodimer with BDNF
    complexed with ipa

Details for d1bndb_

PDB Entry: 1bnd (more details), 2.3 Å

PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer
PDB Compounds: (B:) neurotrophin 3

SCOPe Domain Sequences for d1bndb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bndb_ g.17.1.3 (B:) Neurotrophin 3, NT3 {Human (Homo sapiens) [TaxId: 9606]}
rgevsvcdseslwvtdkssaidirghqvtvlgeiktqnspvkqyfyetrckearpvkngc
rgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrk

SCOPe Domain Coordinates for d1bndb_:

Click to download the PDB-style file with coordinates for d1bndb_.
(The format of our PDB-style files is described here.)

Timeline for d1bndb_: