SCOPe 2.05: Domain d1bndb_: 1bnd B:

Lineage for d1bndb_ (1bnd B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein Neurotrophin 3, NT3 [88884] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88885] (3 PDB entries)

8. Domain d1bndb_: 1bnd B: [44794]
   Other proteins in same PDB: d1bnda_
   heterodimer with BDNF
   complexed with ipa

Details for d1bndb_

PDB Entry: 1bnd, 2.3 Å

PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer

PDB Compounds: (B:) neurotrophin 3

SCOPe Domain Sequences for d1bndb_:

Sequence; same for both SEQRES and ATOM records:

>d1bndb_ g.17.1.3 (B:) Neurotrophin 3, NT3 {Human (Homo sapiens) [TaxId: 9606]}
rgevsvcdseslwvtdkssaidirghqvtvlgeiktqnspvkqyfyetrckearpvkngc
rgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrk

Timeline for d1bndb_:

• d1bndb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bndb_ appears in SCOPe 2.04
  
• d1bndb_ appears in SCOPe 2.06
  
• d1bndb_ appears in the current release, SCOPe 2.08