Lineage for d1bnda_ (1bnd A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891277Family g.17.1.3: Neurotrophin [57520] (4 proteins)
  6. 891293Protein Brain-derived neurotrophic factor, BDNF [88882] (1 species)
  7. 891294Species Human (Homo sapiens) [TaxId:9606] [88883] (2 PDB entries)
  8. 891295Domain d1bnda_: 1bnd A: [44793]
    Other proteins in same PDB: d1bndb_
    heterodimer with NT3
    complexed with ipa

Details for d1bnda_

PDB Entry: 1bnd (more details), 2.3 Å

PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer
PDB Compounds: (A:) brain derived neurotrophic factor

SCOP Domain Sequences for d1bnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnda_ g.17.1.3 (A:) Brain-derived neurotrophic factor, BDNF {Human (Homo sapiens) [TaxId: 9606]}
gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik

SCOP Domain Coordinates for d1bnda_:

Click to download the PDB-style file with coordinates for d1bnda_.
(The format of our PDB-style files is described here.)

Timeline for d1bnda_: