Lineage for d1bnda_ (1bnd A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144107Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 144108Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 144177Family g.17.1.3: Neurotrophin [57520] (3 proteins)
  6. 144189Protein Brain-derived neurotrophic factor/neurotrophin 3 heterodimer, BDNF/NT3 [57521] (1 species)
  7. 144190Species Human (Homo sapiens) [TaxId:9606] [57522] (3 PDB entries)
  8. 144191Domain d1bnda_: 1bnd A: [44793]

Details for d1bnda_

PDB Entry: 1bnd (more details), 2.3 Å

PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer

SCOP Domain Sequences for d1bnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnda_ g.17.1.3 (A:) Brain-derived neurotrophic factor/neurotrophin 3 heterodimer, BDNF/NT3 {Human (Homo sapiens)}
gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik

SCOP Domain Coordinates for d1bnda_:

Click to download the PDB-style file with coordinates for d1bnda_.
(The format of our PDB-style files is described here.)

Timeline for d1bnda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bndb_