Lineage for d1agqd_ (1agq D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638473Protein Glial cell-derived neurotrophic factor, GDNF [57518] (1 species)
  7. 2638474Species Norway rat (Rattus norvegicus) [TaxId:10116] [57519] (1 PDB entry)
  8. 2638478Domain d1agqd_: 1agq D: [44792]

Details for d1agqd_

PDB Entry: 1agq (more details), 1.9 Å

PDB Description: glial cell-derived neurotrophic factor from rat
PDB Compounds: (D:) glial cell-derived neurotrophic factor

SCOPe Domain Sequences for d1agqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agqd_ g.17.1.2 (D:) Glial cell-derived neurotrophic factor, GDNF {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrltsdkvgq
accrpvafdddlsflddslvyhilrkhsakrcgci

SCOPe Domain Coordinates for d1agqd_:

Click to download the PDB-style file with coordinates for d1agqd_.
(The format of our PDB-style files is described here.)

Timeline for d1agqd_: