Lineage for d1agqb_ (1agq B:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. Protein Glial cell-derived neurotrophic factor, GDNF [57518] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [57519] (1 PDB entry)
  8. Domain d1agqb_: 1agq B: [44790]

Details for d1agqb_

PDB Entry: 1agq (more details), 1.9 Å

PDB Description: glial cell-derived neurotrophic factor from rat
PDB Compounds: (B:) glial cell-derived neurotrophic factor

SCOPe Domain Sequences for d1agqb_:

Sequence, based on SEQRES records: (download)

>d1agqb_ g.17.1.2 (B:) Glial cell-derived neurotrophic factor, GDNF {Norway rat (Rattus norvegicus) [TaxId: 10116]}
knrgcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrltsdk
vgqaccrpvafdddlsflddslvyhilrkhsakrcgci

Sequence, based on observed residues (ATOM records): (download)

>d1agqb_ g.17.1.2 (B:) Glial cell-derived neurotrophic factor, GDNF {Norway rat (Rattus norvegicus) [TaxId: 10116]}
knrgcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrltsvg
qaccrpvafdddlsflddslvyhilrkhsakrcgci

SCOPe Domain Coordinates for d1agqb_ are not available.

Timeline for d1agqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1agqa_, d1agqc_, d1agqd_