Lineage for d1agqa_ (1agq A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89754Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 89755Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 89792Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins)
  6. 89801Protein Glial cell-derived neurotrophic factor, GDNF [57518] (1 species)
  7. 89802Species Rat (Rattus norvegicus) [TaxId:10116] [57519] (1 PDB entry)
  8. 89803Domain d1agqa_: 1agq A: [44789]

Details for d1agqa_

PDB Entry: 1agq (more details), 1.9 Å

PDB Description: glial cell-derived neurotrophic factor from rat

SCOP Domain Sequences for d1agqa_:

Sequence, based on SEQRES records: (download)

>d1agqa_ g.17.1.2 (A:) Glial cell-derived neurotrophic factor, GDNF {Rat (Rattus norvegicus)}
nrgcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrrltsdkv
gqaccrpvafdddlsflddslvyhilrkhsakrcgci

Sequence, based on observed residues (ATOM records): (download)

>d1agqa_ g.17.1.2 (A:) Glial cell-derived neurotrophic factor, GDNF {Rat (Rattus norvegicus)}
nrgcvltaihlnvtdlglgyetkeelifrycsgsceaaetmydkilknlsrsrvgqaccr
pvafdddlsflddslvyhilrkhsakrcgci

SCOP Domain Coordinates for d1agqa_:

Click to download the PDB-style file with coordinates for d1agqa_.
(The format of our PDB-style files is described here.)

Timeline for d1agqa_: