Lineage for d1bmpa_ (1bmp A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033727Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)
  7. 3033728Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)
  8. 3033731Domain d1bmpa_: 1bmp A: [44785]

Details for d1bmpa_

PDB Entry: 1bmp (more details), 2.8 Å

PDB Description: bone morphogenetic protein-7
PDB Compounds: (A:) bone morphogenetic protein-7

SCOPe Domain Sequences for d1bmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmpa_ g.17.1.2 (A:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens) [TaxId: 9606]}
qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

SCOPe Domain Coordinates for d1bmpa_:

Click to download the PDB-style file with coordinates for d1bmpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bmpa_: