Lineage for d1klda_ (1kld A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638479Protein TGF-beta1 [57512] (1 species)
  7. 2638480Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries)
  8. 2638493Domain d1klda_: 1kld A: [44781]

Details for d1klda_

PDB Entry: 1kld (more details)

PDB Description: solution structure of tgf-b1, nmr, models 18-33 of 33 structures
PDB Compounds: (A:) transforming growth factor-beta 1

SCOPe Domain Sequences for d1klda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klda_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

SCOPe Domain Coordinates for d1klda_:

Click to download the PDB-style file with coordinates for d1klda_.
(The format of our PDB-style files is described here.)

Timeline for d1klda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kldb_