SCOP 1.57: Domain d1klda_: 1kld A:

Lineage for d1klda_ (1kld A:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins)

6. Protein TGF-beta1 [57512] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57513] (3 PDB entries)

8. Domain d1klda_: 1kld A: [44781]

Details for d1klda_

PDB Entry: 1kld

PDB Description: solution structure of tgf-b1, nmr, models 18-33 of 33 structures

SCOP Domain Sequences for d1klda_:

Sequence; same for both SEQRES and ATOM records:

>d1klda_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens)}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

Timeline for d1klda_:

• d1klda_ first appeared (with stable ids) in SCOP 1.55
  
• d1klda_ appears in SCOP 1.59
  
• d1klda_ appears in the current release, SCOPe 2.08