SCOPe 2.07: Domain d1klaa_: 1kla A:

Lineage for d1klaa_ (1kla A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein TGF-beta1 [57512] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries)

8. Domain d1klaa_: 1kla A: [44779]

Details for d1klaa_

PDB Entry: 1kla

PDB Description: solution structure of tgf-b1, nmr, models 1-17 of 33 structures

PDB Compounds: (A:) transforming growth factor-beta 1

SCOPe Domain Sequences for d1klaa_:

Sequence; same for both SEQRES and ATOM records:

>d1klaa_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

Timeline for d1klaa_:

• d1klaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1klaa_ appears in SCOPe 2.06
  
• d1klaa_ appears in the current release, SCOPe 2.08