Lineage for d2tgia_ (2tgi A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2584990Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2585063Protein TGF-beta2 [57510] (2 species)
  7. 2585064Species Human (Homo sapiens) [TaxId:9606] [57511] (5 PDB entries)
  8. 2585066Domain d2tgia_: 2tgi A: [44777]

Details for d2tgia_

PDB Entry: 2tgi (more details), 1.8 Å

PDB Description: crystal structure of transforming growth factor-beta2: an unusual fold for the superfamily
PDB Compounds: (A:) transforming growth factor ,beta 2

SCOPe Domain Sequences for d2tgia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tgia_ g.17.1.2 (A:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

SCOPe Domain Coordinates for d2tgia_:

Click to download the PDB-style file with coordinates for d2tgia_.
(The format of our PDB-style files is described here.)

Timeline for d2tgia_: