Lineage for d1qtyw_ (1qty W:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063985Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1063986Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1063987Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1063999Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1064002Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
    Uniprot P15692 40-133
  8. 1064030Domain d1qtyw_: 1qty W: [44772]
    Other proteins in same PDB: d1qtyt_, d1qtyu_, d1qtyx_, d1qtyy_

Details for d1qtyw_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
PDB Compounds: (W:) vascular endothelial growth factor

SCOPe Domain Sequences for d1qtyw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtyw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d1qtyw_:

Click to download the PDB-style file with coordinates for d1qtyw_.
(The format of our PDB-style files is described here.)

Timeline for d1qtyw_: