Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries) Uniprot P15692 40-133 |
Domain d1cz8v_: 1cz8 V: [44765] Other proteins in same PDB: d1cz8h1, d1cz8h2, d1cz8l1, d1cz8l2, d1cz8x1, d1cz8x2, d1cz8y1, d1cz8y2 complexed with so4 |
PDB Entry: 1cz8 (more details), 2.4 Å
SCOPe Domain Sequences for d1cz8v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cz8v_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee snitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d1cz8v_: