Lineage for d2vpff_ (2vpf F:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144107Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 144108Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 144109Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 144119Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 144120Species Human (Homo sapiens) [TaxId:9606] [57506] (7 PDB entries)
  8. 144130Domain d2vpff_: 2vpf F: [44760]

Details for d2vpff_

PDB Entry: 2vpf (more details), 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution

SCOP Domain Sequences for d2vpff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpff_ g.17.1.1 (F:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOP Domain Coordinates for d2vpff_:

Click to download the PDB-style file with coordinates for d2vpff_.
(The format of our PDB-style files is described here.)

Timeline for d2vpff_: