SCOPe 2.04: Domain d2vpfd_: 2vpf D:

Lineage for d2vpfd_ (2vpf D:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
   Uniprot P15692 40-133

8. Domain d2vpfd_: 2vpf D: [44758]

Details for d2vpfd_

PDB Entry: 2vpf, 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution

PDB Compounds: (D:) vascular endothelial growth factor

SCOPe Domain Sequences for d2vpfd_:

Sequence; same for both SEQRES and ATOM records:

>d2vpfd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

Timeline for d2vpfd_:

• d2vpfd_ first appeared (with stable ids) in SCOP 1.55
  
• d2vpfd_ appears in SCOPe 2.03
  
• d2vpfd_ appears in SCOPe 2.05
  
• d2vpfd_ appears in the current release, SCOPe 2.08