Lineage for d2vpfd_ (2vpf D:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204064Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 204065Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 204066Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 204076Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 204077Species Human (Homo sapiens) [TaxId:9606] [57506] (7 PDB entries)
  8. 204085Domain d2vpfd_: 2vpf D: [44758]

Details for d2vpfd_

PDB Entry: 2vpf (more details), 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution

SCOP Domain Sequences for d2vpfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpfd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOP Domain Coordinates for d2vpfd_:

Click to download the PDB-style file with coordinates for d2vpfd_.
(The format of our PDB-style files is described here.)

Timeline for d2vpfd_: