Lineage for d1vppw_ (1vpp W:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.1: Platelet-derived growth factor-like [57502] (2 proteins) Protein Vascular endothelial growth factor, VEGF [57505] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57506] (7 PDB entries) 
Domain d1vppw_: 1vpp W: [44754]
Details for d1vppw_
PDB Entry: 1vpp (more details), 1.9 Å
PDB Description: complex between vegf and a receptor blocking peptide
SCOP Domain Sequences for d1vppw_:
Sequence, based on SEQRES records: (download)
>d1vppw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk
Sequence, based on observed residues (ATOM records): (download)
>d1vppw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifieyifkpscvplmrcggccndeglecvpteesnitm
qimrikphqgqhigemsflqhnkcecrpkk
SCOP Domain Coordinates for d1vppw_:
Click to download the PDB-style file with coordinates for d1vppw_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vppw_:
- d1vppw_ appears in SCOP 1.57
- d1vppw_ appears in the current release, SCOPe 2.08
View in 3D
