Lineage for d1vppw_ (1vpp W:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. Domain d1vppw_: 1vpp W: [44754]

Details for d1vppw_

PDB Entry: 1vpp (more details), 1.9 Å

PDB Description: complex between vegf and a receptor blocking peptide
PDB Compounds: (W:) protein (vascular endothelial growth factor)

SCOPe Domain Sequences for d1vppw_:

Sequence, based on SEQRES records: (download)

>d1vppw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

Sequence, based on observed residues (ATOM records): (download)

>d1vppw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifieyifkpscvplmrcggccndeglecvpteesnitm
qimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d1vppw_ are not available.

Timeline for d1vppw_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vppv_