Lineage for d1vppv_ (1vpp V:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.1: Platelet-derived growth factor-like [57502] (2 proteins) Protein Vascular endothelial growth factor, VEGF [57505] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57506] (7 PDB entries) 
Domain d1vppv_: 1vpp V: [44753]
Details for d1vppv_
PDB Entry: 1vpp (more details), 1.9 Å
PDB Description: complex between vegf and a receptor blocking peptide
SCOP Domain Sequences for d1vppv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vppv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk
SCOP Domain Coordinates for d1vppv_:
Click to download the PDB-style file with coordinates for d1vppv_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vppv_:
- d1vppv_ appears in SCOP 1.57
- d1vppv_ appears in the current release, SCOPe 2.08
View in 3D
