Lineage for d1vppv_ (1vpp V:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. Domain d1vppv_: 1vpp V: [44753]

Details for d1vppv_

PDB Entry: 1vpp (more details), 1.9 Å

PDB Description: complex between vegf and a receptor blocking peptide
PDB Compounds: (V:) protein (vascular endothelial growth factor)

SCOPe Domain Sequences for d1vppv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vppv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d1vppv_ are not available.

Timeline for d1vppv_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vppw_