Lineage for d1pdga_ (1pdg A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522937Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 522938Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 522939Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 522946Protein Platelet-derived growth factor BB [57503] (1 species)
  7. 522947Species Human (Homo sapiens) [TaxId:9606] [57504] (1 PDB entry)
  8. 522948Domain d1pdga_: 1pdg A: [44748]

Details for d1pdga_

PDB Entry: 1pdg (more details), 3 Å

PDB Description: crystal structure of human platelet-derived growth factor bb

SCOP Domain Sequences for d1pdga_:

Sequence, based on SEQRES records: (download)

>d1pdga_ g.17.1.1 (A:) Platelet-derived growth factor BB {Human (Homo sapiens)}
epamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcrptqvqlr
pvqvrkieivrkkpifkkatvtledhlackcetvaa

Sequence, based on observed residues (ATOM records): (download)

>d1pdga_ g.17.1.1 (A:) Platelet-derived growth factor BB {Human (Homo sapiens)}
epamiaecktrtevfeisrflvwppcvevqrcsgccnnrnvqcrptqvqlrpvqvrkiei
vrkkpifkkatvtledhlackcetvaa

SCOP Domain Coordinates for d1pdga_:

Click to download the PDB-style file with coordinates for d1pdga_.
(The format of our PDB-style files is described here.)

Timeline for d1pdga_: