Lineage for d1ce3a_ (1ce3 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038566Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 3038567Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 3038568Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins)
  6. 3038569Protein Multidomain proteinase inhibitor [57489] (1 species)
  7. 3038570Species Winged tobacco (Nicotiana alata) [TaxId:4087] [57490] (4 PDB entries)
  8. 3038571Domain d1ce3a_: 1ce3 A: [44728]
    single sequence repeat

Details for d1ce3a_

PDB Entry: 1ce3 (more details)

PDB Description: putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
PDB Compounds: (A:) protein (api)

SCOPe Domain Sequences for d1ce3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce3a_ g.69.1.1 (A:) Multidomain proteinase inhibitor {Winged tobacco (Nicotiana alata) [TaxId: 4087]}
mkactlncdpriaygvcprseekkndrictnccagtkgckyfsddgtfvceges

SCOPe Domain Coordinates for d1ce3a_:

Click to download the PDB-style file with coordinates for d1ce3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ce3a_: