SCOP 1.67: Domain d4sgbi_: 4sgb I:

Lineage for d4sgbi_ (4sgb I:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
   disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III

4. Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family)

5. Family g.69.1.1: Plant proteinase inhibitors [57486] (3 proteins)

6. Protein Plant chymotrypsin inhibitor [57487] (1 species)

7. Species Potato tuber (Solanum tuberosum) [TaxId:4113] [57488] (1 PDB entry)

8. Domain d4sgbi_: 4sgb I: [44724]
   Other proteins in same PDB: d4sgbe_
   complexed with ca, so4

Details for d4sgbi_

PDB Entry: 4sgb, 2.1 Å

PDB Description: structure of the complex of streptomyces griseus proteinase b and polypeptide chymotrypsin inhibitor-1 from russet burbank potato tubers at 2.1 angstroms resolution

SCOP Domain Sequences for d4sgbi_:

Sequence; same for both SEQRES and ATOM records:

>d4sgbi_ g.69.1.1 (I:) Plant chymotrypsin inhibitor {Potato tuber (Solanum tuberosum)}
pictnccagykgcnyysangaficegqsdpkkpkacplncdphiayskcpr

Timeline for d4sgbi_:

• d4sgbi_ first appeared (with stable ids) in SCOP 1.55
  
• d4sgbi_ appears in SCOP 1.65
  
• d4sgbi_ appears in SCOP 1.69
  
• d4sgbi_ appears in the current release, SCOPe 2.08