Lineage for d2bus__ (2bus -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89650Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 89651Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 89652Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 89712Protein Seminal plasma inhibitor IIa [57480] (1 species)
  7. 89713Species Cow (Bos taurus) [TaxId:9913] [57481] (2 PDB entries)
  8. 89714Domain d2bus__: 2bus - [44719]

Details for d2bus__

PDB Entry: 2bus (more details)

PDB Description: solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry

SCOP Domain Sequences for d2bus__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bus__ g.15.1.1 (-) Seminal plasma inhibitor IIa {Cow (Bos taurus)}
egaqvdcaefkdpkvyctresnphcgsngetygnkcafckavmksggkinlkhrgkc

SCOP Domain Coordinates for d2bus__:

Click to download the PDB-style file with coordinates for d2bus__.
(The format of our PDB-style files is described here.)

Timeline for d2bus__: