SCOPe 2.06: Domain d1bmob3: 1bmo B:78-135

Lineage for d1bmob3 (1bmo B:78-135)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
   the C-terminal part of FS module

7. Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)

8. Domain d1bmob3: 1bmo B:78-135 [44718]
   Other proteins in same PDB: d1bmoa1, d1bmoa2, d1bmob1, d1bmob2
   complexed with ca

Details for d1bmob3

PDB Entry: 1bmo, 3.1 Å

PDB Description: bm-40, fs/ec domain pair

PDB Compounds: (B:) bm-40

SCOPe Domain Sequences for d1bmob3:

Sequence; same for both SEQRES and ATOM records:

>d1bmob3 g.68.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

Timeline for d1bmob3:

• d1bmob3 first appeared (with stable ids) in SCOP 1.55
  
• d1bmob3 appears in SCOPe 2.05
  
• d1bmob3 appears in SCOPe 2.07
  
• d1bmob3 appears in the current release, SCOPe 2.08