Lineage for d1bmob3 (1bmo B:78-135)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894337Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 894338Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 894339Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 894359Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
    the C-terminal part of FS module
  7. 894360Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)
  8. 894364Domain d1bmob3: 1bmo B:78-135 [44718]
    Other proteins in same PDB: d1bmoa1, d1bmoa2, d1bmob1, d1bmob2
    complexed with ca, nag

Details for d1bmob3

PDB Entry: 1bmo (more details), 3.1 Å

PDB Description: bm-40, fs/ec domain pair
PDB Compounds: (B:) bm-40

SCOP Domain Sequences for d1bmob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmob3 g.68.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

SCOP Domain Coordinates for d1bmob3:

Click to download the PDB-style file with coordinates for d1bmob3.
(The format of our PDB-style files is described here.)

Timeline for d1bmob3: