Lineage for d1bmoa3 (1bmo A:78-135)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264880Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2264881Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2264882Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2264902Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
    the C-terminal part of FS module
  7. 2264903Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)
  8. 2264906Domain d1bmoa3: 1bmo A:78-135 [44717]
    Other proteins in same PDB: d1bmoa1, d1bmoa2, d1bmob1, d1bmob2
    complexed with ca

Details for d1bmoa3

PDB Entry: 1bmo (more details), 3.1 Å

PDB Description: bm-40, fs/ec domain pair
PDB Compounds: (A:) bm-40

SCOPe Domain Sequences for d1bmoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmoa3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

SCOPe Domain Coordinates for d1bmoa3:

Click to download the PDB-style file with coordinates for d1bmoa3.
(The format of our PDB-style files is described here.)

Timeline for d1bmoa3: