Lineage for d1nubb3 (1nub B:78-135)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067522Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 1067523Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 1067524Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 1067544Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
    the C-terminal part of FS module
  7. 1067545Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)
  8. 1067547Domain d1nubb3: 1nub B:78-135 [44716]
    Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2
    complexed with ca; mutant

Details for d1nubb3

PDB Entry: 1nub (more details), 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair
PDB Compounds: (B:) basement membrane protein bm-40

SCOPe Domain Sequences for d1nubb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nubb3 g.68.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

SCOPe Domain Coordinates for d1nubb3:

Click to download the PDB-style file with coordinates for d1nubb3.
(The format of our PDB-style files is described here.)

Timeline for d1nubb3: