Lineage for d1nubb3 (1nub B:78-135)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203954Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 203955Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 203956Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)
  6. 203973Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
  7. 203974Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)
  8. 203976Domain d1nubb3: 1nub B:78-135 [44716]
    Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2

Details for d1nubb3

PDB Entry: 1nub (more details), 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

SCOP Domain Sequences for d1nubb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nubb3 g.15.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

SCOP Domain Coordinates for d1nubb3:

Click to download the PDB-style file with coordinates for d1nubb3.
(The format of our PDB-style files is described here.)

Timeline for d1nubb3: