SCOP 1.63: Domain d1nuba3: 1nub A:78-135

Lineage for d1nuba3 (1nub A:78-135)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
   disulphide-rich small alpha+beta fold

4. Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families)
   two families share the same beta-sheet topology but differ in the active-site loop location

5. Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)

6. Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
   the C-terminal part of FS module

7. Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)

8. Domain d1nuba3: 1nub A:78-135 [44715]
   Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2

Details for d1nuba3

PDB Entry: 1nub, 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

SCOP Domain Sequences for d1nuba3:

Sequence; same for both SEQRES and ATOM records:

>d1nuba3 g.15.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

Timeline for d1nuba3:

• d1nuba3 first appeared (with stable ids) in SCOP 1.55
  
• d1nuba3 appears in SCOP 1.61
  
• d1nuba3 appears in SCOP 1.65
  
• d1nuba3 appears in the current release, SCOPe 2.08