| Class g: Small proteins [56992] (61 folds) |
| Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily) disulphide-rich small alpha+beta fold |
Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) ![]() two families share the same beta-sheet topology but differ in the active-site loop location |
| Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins) |
| Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species) the C-terminal part of FS module |
| Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries) |
| Domain d1nuba3: 1nub A:78-135 [44715] Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2 |
PDB Entry: 1nub (more details), 2.8 Å
SCOP Domain Sequences for d1nuba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nuba3 g.15.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi
Timeline for d1nuba3: