Lineage for d1tbqs2 (1tbq S:52-103)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643121Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2643122Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2643123Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2643127Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species)
    duplication: contains two domains of this fold
  7. 2643128Species Rhodnius prolixus, rhodniin [TaxId:13249] [57477] (2 PDB entries)
  8. 2643136Domain d1tbqs2: 1tbq S:52-103 [44714]
    Other proteins in same PDB: d1tbq.1, d1tbq.2

Details for d1tbqs2

PDB Entry: 1tbq (more details), 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
PDB Compounds: (S:) rhodniin

SCOPe Domain Sequences for d1tbqs2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbqs2 g.68.1.1 (S:52-103) Blood-sucking insect-derived tryptase inhibitor {Rhodnius prolixus, rhodniin [TaxId: 13249]}
ededvcqecdgdeykpvcgsdditydnncrlecasissspgvelkhegpcrt

SCOPe Domain Coordinates for d1tbqs2:

Click to download the PDB-style file with coordinates for d1tbqs2.
(The format of our PDB-style files is described here.)

Timeline for d1tbqs2: