SCOPe 2.06: Domain d1tbqr2: 1tbq R:52-103

Lineage for d1tbqr2 (1tbq R:52-103)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species)
   duplication: contains two domains of this fold

7. Species Rhodnius prolixus, rhodniin [TaxId:13249] [57477] (2 PDB entries)

8. Domain d1tbqr2: 1tbq R:52-103 [44712]
   Other proteins in same PDB: d1tbq.1, d1tbq.2

Details for d1tbqr2

PDB Entry: 1tbq, 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

PDB Compounds: (R:) rhodniin

SCOPe Domain Sequences for d1tbqr2:

Sequence; same for both SEQRES and ATOM records:

>d1tbqr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Rhodnius prolixus, rhodniin [TaxId: 13249]}
ededvcqecdgdeykpvcgsdditydnncrlecasissspgvelkhegpcrt

Timeline for d1tbqr2:

• d1tbqr2 first appeared (with stable ids) in SCOP 1.55
  
• d1tbqr2 appears in SCOPe 2.05
  
• d1tbqr2 appears in SCOPe 2.07
  
• d1tbqr2 appears in the current release, SCOPe 2.08