Lineage for d1tbrs1 (1tbr S:1-51)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203954Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 203955Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 203956Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)
  6. 203960Protein Blood-sucking insect-derived tryptase inhibitor [57476] (1 species)
  7. 203961Species Bug (Rhodnius prolixus), rhodniin [TaxId:13249] [57477] (2 PDB entries)
  8. 203964Domain d1tbrs1: 1tbr S:1-51 [44709]
    Other proteins in same PDB: d1tbr.1, d1tbr.2

Details for d1tbrs1

PDB Entry: 1tbr (more details), 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbrs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbrs1 g.15.1.1 (S:1-51) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin}
eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepd

SCOP Domain Coordinates for d1tbrs1:

Click to download the PDB-style file with coordinates for d1tbrs1.
(The format of our PDB-style files is described here.)

Timeline for d1tbrs1: