SCOP 1.59: Domain d1tbrs1: 1tbr S:1-51

Lineage for d1tbrs1 (1tbr S:1-51)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)

4. Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families)

5. Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)

6. Protein Rhodniin [57476] (1 species)

7. Species Bug (Rhodnius prolixus) [TaxId:13249] [57477] (2 PDB entries)

8. Domain d1tbrs1: 1tbr S:1-51 [44709]
   Other proteins in same PDB: d1tbr.1, d1tbr.2

Details for d1tbrs1

PDB Entry: 1tbr, 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbrs1:

Sequence; same for both SEQRES and ATOM records:

>d1tbrs1 g.15.1.1 (S:1-51) Rhodniin {Bug (Rhodnius prolixus)}
eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepd

Timeline for d1tbrs1:

• d1tbrs1 first appeared (with stable ids) in SCOP 1.55
  
• d1tbrs1 appears in SCOP 1.57
  
• d1tbrs1 appears in SCOP 1.61
  
• d1tbrs1 appears in the current release, SCOPe 2.08